SCOPe 2.04: Domain d3zvhb1: 3zvh B:1-160

Lineage for d3zvhb1 (3zvh B:1-160)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries)

8. Domain d3zvhb1: 3zvh B:1-160 [218537]
   Other proteins in same PDB: d3zvha2, d3zvhb2
   automated match to d1kkoa2
   complexed with cl, gol, mg; mutant

Details for d3zvhb1

PDB Entry: 3zvh, 1.99 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a

PDB Compounds: (B:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvhb1:

Sequence; same for both SEQRES and ATOM records:

>d3zvhb1 d.54.1.0 (B:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp

Timeline for d3zvhb1:

• d3zvhb1 first appeared in SCOPe 2.03
  
• d3zvhb1 appears in SCOPe 2.05
  
• d3zvhb1 appears in the current release, SCOPe 2.08