Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Clostridium tetanomorphum [TaxId:1553] [226805] (2 PDB entries) |
Domain d3zvha2: 3zvh A:161-415 [218536] Other proteins in same PDB: d3zvha1, d3zvhb1 automated match to d1kkoa1 complexed with cl, gol, mg; mutant |
PDB Entry: 3zvh (more details), 1.99 Å
SCOPe Domain Sequences for d3zvha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvha2 c.1.11.0 (A:161-415) automated matches {Clostridium tetanomorphum [TaxId: 1553]} gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn emnrvlalvgrrkkl
Timeline for d3zvha2: