Lineage for d1a47a1 (1a47 A:496-578)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937637Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (5 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 937698Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (2 PDB entries)
  8. 937700Domain d1a47a1: 1a47 A:496-578 [21853]
    Other proteins in same PDB: d1a47a2, d1a47a3, d1a47a4
    complexed with ca

Details for d1a47a1

PDB Entry: 1a47 (more details), 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1a47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a47a1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

SCOPe Domain Coordinates for d1a47a1:

Click to download the PDB-style file with coordinates for d1a47a1.
(The format of our PDB-style files is described here.)

Timeline for d1a47a1: