SCOP 1.73: Domain d1a47a1: 1a47 A:496-578

Lineage for d1a47a1 (1a47 A:496-578)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (2 PDB entries)

8. Domain d1a47a1: 1a47 A:496-578 [21853]
   Other proteins in same PDB: d1a47a2, d1a47a3, d1a47a4
   complexed with ca, cyl, glc, gld, gte

Details for d1a47a1

PDB Entry: 1a47, 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1a47a1:

Sequence; same for both SEQRES and ATOM records:

>d1a47a1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

Timeline for d1a47a1:

• d1a47a1 first appeared (with stable ids) in SCOP 1.55, called d1a47_1
  
• d1a47a1 was called d1a47_1 in SCOP 1.71
  
• d1a47a1 appears in SCOP 1.75
  
• d1a47a1 appears in the current release, SCOPe 2.08