Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries) |
Domain d3zunj_: 3zun J: [218525] Other proteins in same PDB: d3zunb_, d3zunc_, d3zune_, d3zunf_, d3zunh_, d3zuni_, d3zunk_, d3zunl_ automated match to d1lm8b_ complexed with gol, zun |
PDB Entry: 3zun (more details), 2.5 Å
SCOPe Domain Sequences for d3zunj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zunj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
Timeline for d3zunj_: