Lineage for d3zunj_ (3zun J:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177302Domain d3zunj_: 3zun J: [218525]
    Other proteins in same PDB: d3zunb_, d3zunc_, d3zune_, d3zunf_, d3zunh_, d3zuni_, d3zunk_, d3zunl_
    automated match to d1lm8b_
    complexed with gol, zun

Details for d3zunj_

PDB Entry: 3zun (more details), 2.5 Å

PDB Description: pvhl54-213-elob-eloc complex_(2s,4r)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-n-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zunj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zunj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d3zunj_:

Click to download the PDB-style file with coordinates for d3zunj_.
(The format of our PDB-style files is described here.)

Timeline for d3zunj_: