Lineage for d1ciua1 (1ciu A:496-578)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658718Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 658779Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (2 PDB entries)
  8. 658780Domain d1ciua1: 1ciu A:496-578 [21852]
    Other proteins in same PDB: d1ciua2, d1ciua3, d1ciua4
    complexed with ca

Details for d1ciua1

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1ciua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciua1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

SCOP Domain Coordinates for d1ciua1:

Click to download the PDB-style file with coordinates for d1ciua1.
(The format of our PDB-style files is described here.)

Timeline for d1ciua1: