SCOP 1.67: Domain d1ciu_1: 1ciu 496-578

Lineage for d1ciu_1 (1ciu 496-578)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (2 PDB entries)

8. Domain d1ciu_1: 1ciu 496-578 [21852]
   Other proteins in same PDB: d1ciu_2, d1ciu_3, d1ciu_4
   complexed with ca

Details for d1ciu_1

PDB Entry: 1ciu, 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

SCOP Domain Sequences for d1ciu_1:

Sequence; same for both SEQRES and ATOM records:

>d1ciu_1 b.1.18.2 (496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

Timeline for d1ciu_1:

• d1ciu_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ciu_1 appears in SCOP 1.65
  
• d1ciu_1 appears in SCOP 1.69
  
• d1ciu_1 appears in the current release, SCOPe 2.08, called d1ciua1