Lineage for d1ciu_1 (1ciu 496-578)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54548Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 54592Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (2 PDB entries)
  8. 54593Domain d1ciu_1: 1ciu 496-578 [21852]
    Other proteins in same PDB: d1ciu_2, d1ciu_3, d1ciu_4

Details for d1ciu_1

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

SCOP Domain Sequences for d1ciu_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciu_1 b.1.1.5 (496-578) Cyclodextrin glycosyltransferase, domain E {Thermoanaerobacterium thermosulfurigenes, EM1}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

SCOP Domain Coordinates for d1ciu_1:

Click to download the PDB-style file with coordinates for d1ciu_1.
(The format of our PDB-style files is described here.)

Timeline for d1ciu_1: