Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [193801] (5 PDB entries) |
Domain d3ztqd_: 3ztq D: [218487] automated match to d3ztoa_ |
PDB Entry: 3ztq (more details), 2.1 Å
SCOPe Domain Sequences for d3ztqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztqd_ d.58.6.0 (D:) automated matches {Aquifex aeolicus [TaxId: 63363]} avertliivkpdamekgalgkildrfiqegfqikalkmfrftpekagefyyvhrerpffq elvefmssgpvvaavlegedaikrvreiigptdseearkvapnsiraqfgtdkgknaiha sdspesaqyeicfifsgleiv
Timeline for d3ztqd_: