Lineage for d1d7fa1 (1d7f A:497-582)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456196Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 456226Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 456268Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries)
  8. 456271Domain d1d7fa1: 1d7f A:497-582 [21848]
    Other proteins in same PDB: d1d7fa2, d1d7fa3, d1d7fa4, d1d7fb2, d1d7fb3, d1d7fb4

Details for d1d7fa1

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution

SCOP Domain Sequences for d1d7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fa1 b.1.18.2 (A:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOP Domain Coordinates for d1d7fa1:

Click to download the PDB-style file with coordinates for d1d7fa1.
(The format of our PDB-style files is described here.)

Timeline for d1d7fa1: