Lineage for d1pamb1 (1pam B:497-582)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54548Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 54578Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (4 PDB entries)
  8. 54580Domain d1pamb1: 1pam B:497-582 [21847]
    Other proteins in same PDB: d1pama2, d1pama3, d1pama4, d1pamb2, d1pamb3, d1pamb4

Details for d1pamb1

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase

SCOP Domain Sequences for d1pamb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pamb1 b.1.1.5 (B:497-582) Cyclodextrin glycosyltransferase, domain E {Bacillus sp., strain 1011}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOP Domain Coordinates for d1pamb1:

Click to download the PDB-style file with coordinates for d1pamb1.
(The format of our PDB-style files is described here.)

Timeline for d1pamb1: