![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
![]() | Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries) Uniprot P05618 |
![]() | Domain d1pamb1: 1pam B:497-582 [21847] Other proteins in same PDB: d1pama2, d1pama3, d1pama4, d1pamb2, d1pamb3, d1pamb4 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1pam (more details), 1.8 Å
SCOPe Domain Sequences for d1pamb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pamb1 b.1.18.2 (B:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011 [TaxId: 1409]} ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav pggiydirvanaagaasniydnfevl
Timeline for d1pamb1:
![]() Domains from other chains: (mouse over for more information) d1pama1, d1pama2, d1pama3, d1pama4 |