Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein automated matches [193392] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
Domain d3ztcf_: 3ztc F: [218463] Other proteins in same PDB: d3ztca_, d3ztcb_, d3ztcd_, d3ztce_, d3ztcg_, d3ztch_, d3ztcj_, d3ztck_ automated match to d4awjf_ complexed with tr0 |
PDB Entry: 3ztc (more details), 2.65 Å
SCOPe Domain Sequences for d3ztcf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztcf_ b.3.3.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr slyedledhpnvqkdlerltqe
Timeline for d3ztcf_: