SCOPe 2.08: Domain d1qhpa1: 1qhp A:496-576

Lineage for d1qhpa1 (1qhp A:496-576)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Five domain 'maltogenic' alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D [81280] (1 species)
   domain architecture similar to cyclomaltodextrin glycosylhydrolases

7. Species Bacillus stearothermophilus [TaxId:1422] [81281] (2 PDB entries)

8. Domain d1qhpa1: 1qhp A:496-576 [21845]
   Other proteins in same PDB: d1qhpa2, d1qhpa3, d1qhpa4
   complexed with ca, so4

Details for d1qhpa1

PDB Entry: 1qhp, 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhpa1:

Sequence; same for both SEQRES and ATOM records:

>d1qhpa1 b.1.18.2 (A:496-576) Five domain 'maltogenic' alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]}
asapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvkswtsnrievyvpnmaa
gltdvkvtaggvssnlysyni

Timeline for d1qhpa1:

• d1qhpa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qhpa1 appears in SCOPe 2.07