SCOP 1.57: Domain d1cyg_1: 1cyg 492-574

Lineage for d1cyg_1 (1cyg 492-574)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (24 proteins)

6. Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [49217] (1 PDB entry)

8. Domain d1cyg_1: 1cyg 492-574 [21843]
   Other proteins in same PDB: d1cyg_2, d1cyg_3, d1cyg_4

Details for d1cyg_1

PDB Entry: 1cyg, 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

SCOP Domain Sequences for d1cyg_1:

Sequence; same for both SEQRES and ATOM records:

>d1cyg_1 b.1.1.5 (492-574) Cyclodextrin glycosyltransferase, domain E {Bacillus stearothermophilus}
estpiighvgpmmgqvghqvtidgegfgtntgtvkfgttaanvvswsnnqivvavpnvsp
gkynitvqsssgqtsaaydnfev

Timeline for d1cyg_1:

• d1cyg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cyg_1 appears in SCOP 1.59
  
• d1cyg_1 appears in the current release, SCOPe 2.08, called d1cyga1