Lineage for d1cyg_1 (1cyg 492-574)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus stearothermophilus [TaxId:1422] [49217] (1 PDB entry) 
Domain d1cyg_1: 1cyg 492-574 [21843]
Other proteins in same PDB: d1cyg_2, d1cyg_3, d1cyg_4
Details for d1cyg_1
PDB Entry: 1cyg (more details), 2.5 Å
PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)
SCOP Domain Sequences for d1cyg_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyg_1 b.1.1.5 (492-574) Cyclodextrin glycosyltransferase, domain E {Bacillus stearothermophilus}
estpiighvgpmmgqvghqvtidgegfgtntgtvkfgttaanvvswsnnqivvavpnvsp
gkynitvqsssgqtsaaydnfev
SCOP Domain Coordinates for d1cyg_1:
Click to download the PDB-style file with coordinates for d1cyg_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cyg_1:
- d1cyg_1 appears in SCOP 1.57
- d1cyg_1 appears in the current release, SCOPe 2.08, called d1cyga1
View in 3D
