Lineage for d3zsea_ (3zse A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780331Species Thermobifida fusca [TaxId:2021] [226300] (1 PDB entry)
  8. 2780332Domain d3zsea_: 3zse A: [218428]
    automated match to d1hixb_
    complexed with edo

Details for d3zsea_

PDB Entry: 3zse (more details), 1.78 Å

PDB Description: 3d structure of a thermophilic family gh11 xylanase from thermobifida fusca
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3zsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zsea_ b.29.1.11 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
avtsnqtgyhdgyfysfwtdapgtvsmelgpggnystswrntgnfvagkgwatggrrtvt
ysasfnpsgnayltlygwtrnplveyyiveswgtyrptgtymgtvttdggtydiykttry
napsiegtrtfdqywsvrqskrtsgtitagnhfdawarhgmhlgthdymimategyqssg
ssnvtlgt

SCOPe Domain Coordinates for d3zsea_:

Click to download the PDB-style file with coordinates for d3zsea_.
(The format of our PDB-style files is described here.)

Timeline for d3zsea_: