Lineage for d1cxf_1 (1cxf 496-581)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456196Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 456226Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 456227Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 456265Domain d1cxf_1: 1cxf 496-581 [21841]
    Other proteins in same PDB: d1cxf_2, d1cxf_3, d1cxf_4

Details for d1cxf_1

PDB Entry: 1cxf (more details), 2.6 Å

PDB Description: complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin

SCOP Domain Sequences for d1cxf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxf_1 b.1.18.2 (496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1cxf_1:

Click to download the PDB-style file with coordinates for d1cxf_1.
(The format of our PDB-style files is described here.)

Timeline for d1cxf_1: