![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (49 PDB entries) |
![]() | Domain d3zrcd_: 3zrc D: [218407] Other proteins in same PDB: d3zrcb_, d3zrcc_, d3zrce_, d3zrcf_, d3zrch_, d3zrci_, d3zrck_, d3zrcl_ automated match to d1lm8b_ complexed with l8b |
PDB Entry: 3zrc (more details), 2.9 Å
SCOPe Domain Sequences for d3zrcd_:
Sequence, based on SEQRES records: (download)
>d3zrcd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpd
>d3zrcd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafrtfealciepfssppelpd
Timeline for d3zrcd_: