SCOPe 2.06: Domain d3zqab_: 3zqa B:

Lineage for d3zqab_ (3zqa B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (49 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [225751] (7 PDB entries)

8. Domain d3zqab_: 3zqa B: [218401]
   automated match to d1o9ja_
   complexed with edo, gol, k, ndp, pg4, toe; mutant

Details for d3zqab_

PDB Entry: 3zqa, 2.45 Å

PDB Description: crystallographic structure of betaine aldehyde dehydrogenase mutant c286a from pseudomonas aeruginosa in complex with nadph

PDB Compounds: (B:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d3zqab_:

Sequence; same for both SEQRES and ATOM records:

>d3zqab_ c.82.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
sssslkevtmelggkspliifpdadldraadiavmanffssgqvatngtrvfihrsqqar
feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
elgdyasvf

Timeline for d3zqab_:

• d3zqab_ first appeared in SCOPe 2.03
  
• d3zqab_ appears in SCOPe 2.05
  
• d3zqab_ appears in SCOPe 2.07
  
• d3zqab_ appears in the current release, SCOPe 2.08