SCOP 1.75: Domain d6cgta1: 6cgt A:495-579

Lineage for d6cgta1 (6cgt A:495-579)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (5 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)

8. Domain d6cgta1: 6cgt A:495-579 [21837]
   Other proteins in same PDB: d6cgta2, d6cgta3, d6cgta4
   complexed with ca, dag, glc, opg; mutant

Details for d6cgta1

PDB Entry: 6cgt, 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d6cgta1:

Sequence; same for both SEQRES and ATOM records:

>d6cgta1 b.1.18.2 (A:495-579) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

Timeline for d6cgta1:

• d6cgta1 first appeared (with stable ids) in SCOP 1.55, called d6cgt_1
  
• d6cgta1 appears in SCOP 1.73
  
• d6cgta1 appears in SCOPe 2.01
  
• d6cgta1 appears in the current release, SCOPe 2.08