Lineage for d6cgt_1 (6cgt 495-579)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9616Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 9617Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries)
  8. 9638Domain d6cgt_1: 6cgt 495-579 [21837]
    Other proteins in same PDB: d6cgt_2, d6cgt_3, d6cgt_4

Details for d6cgt_1

PDB Entry: 6cgt (more details), 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant

SCOP Domain Sequences for d6cgt_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cgt_1 b.1.1.5 (495-579) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

SCOP Domain Coordinates for d6cgt_1:

Click to download the PDB-style file with coordinates for d6cgt_1.
(The format of our PDB-style files is described here.)

Timeline for d6cgt_1: