Lineage for d2dij_1 (2dij 497-583)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105015Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 105016Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 105037Domain d2dij_1: 2dij 497-583 [21836]
    Other proteins in same PDB: d2dij_2, d2dij_3, d2dij_4

Details for d2dij_1

PDB Entry: 2dij (more details), 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose

SCOP Domain Sequences for d2dij_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dij_1 b.1.1.5 (497-583) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

SCOP Domain Coordinates for d2dij_1:

Click to download the PDB-style file with coordinates for d2dij_1.
(The format of our PDB-style files is described here.)

Timeline for d2dij_1: