Lineage for d1tcma1 (1tcm A:496-581)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54548Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 54549Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries)
  8. 54566Domain d1tcma1: 1tcm A:496-581 [21833]
    Other proteins in same PDB: d1tcma2, d1tcma3, d1tcma4, d1tcmb2, d1tcmb3, d1tcmb4

Details for d1tcma1

PDB Entry: 1tcm (more details), 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251

SCOP Domain Sequences for d1tcma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcma1 b.1.1.5 (A:496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1tcma1:

Click to download the PDB-style file with coordinates for d1tcma1.
(The format of our PDB-style files is described here.)

Timeline for d1tcma1: