SCOPe 2.05: Domain d8cgta1: 8cgt A:495-579

Lineage for d8cgta1 (8cgt A:495-579)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)

8. Domain d8cgta1: 8cgt A:495-579 [21831]
   Other proteins in same PDB: d8cgta2, d8cgta3, d8cgta4
   complexed with ca, tm6

Details for d8cgta1

PDB Entry: 8cgt, 2.4 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose

PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d8cgta1:

Sequence; same for both SEQRES and ATOM records:

>d8cgta1 b.1.18.2 (A:495-579) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

Timeline for d8cgta1:

• d8cgta1 first appeared (with stable ids) in SCOP 1.55
  
• d8cgta1 appears in SCOPe 2.04
  
• d8cgta1 appears in SCOPe 2.06
  
• d8cgta1 appears in the current release, SCOPe 2.08