Lineage for d9cgta1 (9cgt A:495-579)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries) 
Domain d9cgta1: 9cgt A:495-579 [21830]
Other proteins in same PDB: d9cgta2, d9cgta3, d9cgta4
Details for d9cgta1
PDB Entry: 9cgt (more details), 2.5 Å
PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltopentaose
SCOP Domain Sequences for d9cgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d9cgta1 b.1.1.5 (A:495-579) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti
SCOP Domain Coordinates for d9cgta1:
Click to download the PDB-style file with coordinates for d9cgta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9cgta1:
- d9cgta1 appears in SCOP 1.57
- d9cgta1 appears in the current release, SCOPe 2.08
View in 3D
