Lineage for d1cxla1 (1cxl A:497-583)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375146Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2375192Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 2375193Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 2375194Domain d1cxla1: 1cxl A:497-583 [21829]
    Other proteins in same PDB: d1cxla2, d1cxla3, d1cxla4
    complexed with ca, mpd

Details for d1cxla1

PDB Entry: 1cxl (more details), 1.81 Å

PDB Description: complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d1cxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

SCOPe Domain Coordinates for d1cxla1:

Click to download the PDB-style file with coordinates for d1cxla1.
(The format of our PDB-style files is described here.)

Timeline for d1cxla1: