Lineage for d3zgda_ (3zgd A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.11: Kelch motif [117281] (2 families) 
Family b.68.11.1: Kelch motif [117282] (2 proteins)
Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
Protein automated matches [190126] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193097] (24 PDB entries) 
Domain d3zgda_: 3zgd A: [218289]
automated match to d1zgka1
complexed with act, na; mutant
Details for d3zgda_
PDB Entry: 3zgd (more details), 1.98 Å
PDB Description: crystal structure of a KEAP1 mutant
PDB Compounds: (A:) Kelch-like ECH-associated protein 1SCOPe Domain Sequences for d3zgda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zgda_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
SCOPe Domain Coordinates for d3zgda_:
Click to download the PDB-style file with coordinates for d3zgda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zgda_:
- d3zgda_ first appeared in SCOPe 2.03
- d3zgda_ appears in SCOPe 2.07
View in 3D
