SCOP 1.59: Domain d4cgt_1: 4cgt 496-581

Lineage for d4cgt_1 (4cgt 496-581)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (25 proteins)

6. Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)

8. Domain d4cgt_1: 4cgt 496-581 [21825]
   Other proteins in same PDB: d4cgt_2, d4cgt_3, d4cgt_4

Details for d4cgt_1

PDB Entry: 4cgt, 2.6 Å

PDB Description: deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase

SCOP Domain Sequences for d4cgt_1:

Sequence; same for both SEQRES and ATOM records:

>d4cgt_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ttptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtipsv
aagnyavkvaasgvnsnaynnftilt

Timeline for d4cgt_1:

• d4cgt_1 first appeared (with stable ids) in SCOP 1.55
  
• d4cgt_1 appears in SCOP 1.57
  
• d4cgt_1 appears in SCOP 1.61
  
• d4cgt_1 appears in the current release, SCOPe 2.08, called d4cgta1