SCOPe 2.05: Domain d3wffa_: 3wff A:

Lineage for d3wffa_ (3wff A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)

8. Domain d3wffa_: 3wff A: [218235]
   automated match to d2aa6b_
   complexed with po4, wff

Details for d3wffa_

PDB Entry: 3wff, 2.05 Å

PDB Description: mineralocorticoid receptor ligand-binding domain with compound 2b

PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d3wffa_:

Sequence; same for both SEQRES and ATOM records:

>d3wffa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakv
lpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamy
elcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkm
vtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisd
qlpkvesgnvkplyfhrk

Timeline for d3wffa_:

• d3wffa_ first appeared in SCOPe 2.03
  
• d3wffa_ appears in SCOPe 2.04
  
• d3wffa_ appears in SCOPe 2.06
  
• d3wffa_ appears in the current release, SCOPe 2.08