SCOPe 2.05: Domain d3wcqa_: 3wcq A:

Lineage for d3wcqa_ (3wcq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (8 species)
   not a true protein

7. Species Cyanidioschyzon merolae [TaxId:45157] [189509] (2 PDB entries)

8. Domain d3wcqa_: 3wcq A: [218233]
   automated match to d3b2ga_
   complexed with fes; mutant

Details for d3wcqa_

PDB Entry: 3wcq, 0.97 Å

PDB Description: Crystal structure analysis of Cyanidioschyzon melorae ferredoxin D58N mutant

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3wcqa_:

Sequence; same for both SEQRES and ATOM records:

>d3wcqa_ d.15.4.1 (A:) automated matches {Cyanidioschyzon merolae [TaxId: 45157]}
mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvnqs
dqsfldedqiskgfiltcvayptsdcviqthqeealy

Timeline for d3wcqa_:

• d3wcqa_ first appeared in SCOPe 2.03
  
• d3wcqa_ appears in SCOPe 2.04
  
• d3wcqa_ appears in SCOPe 2.06
  
• d3wcqa_ appears in the current release, SCOPe 2.08