Lineage for d1cgwa1 (1cgw A:496-581)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299506Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1299551Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 1299552Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 1299578Domain d1cgwa1: 1cgw A:496-581 [21822]
    Other proteins in same PDB: d1cgwa2, d1cgwa3, d1cgwa4
    complexed with ca, mal; mutant

Details for d1cgwa1

PDB Entry: 1cgw (more details), 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1cgwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgwa1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOPe Domain Coordinates for d1cgwa1:

Click to download the PDB-style file with coordinates for d1cgwa1.
(The format of our PDB-style files is described here.)

Timeline for d1cgwa1: