SCOPe 2.04: Domain d3w5ja_: 3w5j A:

Lineage for d3w5ja_ (3w5j A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Gallionella capsiferriformans [TaxId:395494] [226649] (2 PDB entries)

8. Domain d3w5ja_: 3w5j A: [218218]
   automated match to d2cxxa1
   complexed with gdp, gol, so4

Details for d3w5ja_

PDB Entry: 3w5j, 1.93 Å

PDB Description: Crystal structure of GDP-bound NfeoB from Gallionella capsiferriformans

PDB Compounds: (A:) Ferrous iron transport protein B

SCOPe Domain Sequences for d3w5ja_:

Sequence, based on SEQRES records:

>d3w5ja_ c.37.1.0 (A:) automated matches {Gallionella capsiferriformans [TaxId: 395494]}
qfkriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiy
dlhgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdea
kqygitidsrkmsellqipvfqlsgkygtgyqealqavtralryptpgmaenvrtqleqd
ehieaemvrilksavqip

Sequence, based on observed residues (ATOM records):

>d3w5ja_ c.37.1.0 (A:) automated matches {Gallionella capsiferriformans [TaxId: 395494]}
qfkriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiy
dlhgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdea
kqygitidsrkmsellqipvfqlstgyqealqavtralryptpgmaenvrtqleqdehie
aemvrilksavqip

Timeline for d3w5ja_:

• d3w5ja_ first appeared in SCOPe 2.03
  
• d3w5ja_ appears in SCOPe 2.05
  
• d3w5ja_ appears in the current release, SCOPe 2.08, called d3w5ja1