Lineage for d3w5ib1 (3w5i B:2-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871976Species Gallionella capsiferriformans [TaxId:395494] [226649] (2 PDB entries)
  8. 2871980Domain d3w5ib1: 3w5i B:2-200 [218217]
    Other proteins in same PDB: d3w5ia2, d3w5ib2
    automated match to d2cxxa1
    complexed with so4

Details for d3w5ib1

PDB Entry: 3w5i (more details), 2.15 Å

PDB Description: Crystal structure of NfeoB from Gallionella capsiferriformans
PDB Compounds: (B:) Ferrous iron transport protein B

SCOPe Domain Sequences for d3w5ib1:

Sequence, based on SEQRES records: (download)

>d3w5ib1 c.37.1.0 (B:2-200) automated matches {Gallionella capsiferriformans [TaxId: 395494]}
kriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiydl
hgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeakq
ygitidsrkmsellqipvfqlsgkygtgyqealqavtralryptpgmaenvrtqleqdeh
ieaemvrilksavqiparl

Sequence, based on observed residues (ATOM records): (download)

>d3w5ib1 c.37.1.0 (B:2-200) automated matches {Gallionella capsiferriformans [TaxId: 395494]}
kriallgmpntgkstlfnrmtggaarvgnwpgitvellsgkillgadmveiidlpgiydl
hgfsddeqvvrhflhdnvpdlalvilnatqierqmslllqlkqlnmnivvllnmsdeakq
ygitidsrkmsellqipvfqlsgtgyqealqavtralryptpgmaenvrtqleqdehiea
emvrilksavqiparl

SCOPe Domain Coordinates for d3w5ib1:

Click to download the PDB-style file with coordinates for d3w5ib1.
(The format of our PDB-style files is described here.)

Timeline for d3w5ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w5ib2