Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins) interrupted by a large insertion, domain N |
Protein Calcium ATPase, catalytic domain P [81655] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (42 PDB entries) Uniprot P04191 |
Domain d3w5ca3: 3w5c A:344-360,A:600-750 [218206] Other proteins in same PDB: d3w5ca1, d3w5ca2, d3w5ca4 automated match to d1wpga2 complexed with na, pty |
PDB Entry: 3w5c (more details), 2.5 Å
SCOPe Domain Sequences for d3w5ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w5ca3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg
Timeline for d3w5ca3: