Lineage for d3w2ia2 (3w2i A:126-272)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859733Protein cytochrome b5 reductase [52357] (3 species)
  7. 2859741Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (9 PDB entries)
  8. 2859748Domain d3w2ia2: 3w2i A:126-272 [218195]
    Other proteins in same PDB: d3w2ia1
    automated match to d1umka2
    complexed with fad, nad

Details for d3w2ia2

PDB Entry: 3w2i (more details), 1.81 Å

PDB Description: Crystal structure of re-oxidized form (60 min) of NADH-cytochrome b5 reductase from pig liver
PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d3w2ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w2ia2 c.25.1.1 (A:126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf

SCOPe Domain Coordinates for d3w2ia2:

Click to download the PDB-style file with coordinates for d3w2ia2.
(The format of our PDB-style files is described here.)

Timeline for d3w2ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w2ia1