Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein cytochrome b5 reductase [50427] (3 species) |
Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (7 PDB entries) |
Domain d3w2ia1: 3w2i A:2-125 [218194] Other proteins in same PDB: d3w2ia2 automated match to d1umka1 complexed with fad, nad |
PDB Entry: 3w2i (more details), 1.81 Å
SCOPe Domain Sequences for d3w2ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w2ia1 b.43.4.2 (A:2-125) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]} tpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnlv irpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngllv yqgk
Timeline for d3w2ia1: