Lineage for d3w27a_ (3w27 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1571050Species Thermoanaerobacterium saccharolyticum [TaxId:1094508] [196751] (6 PDB entries)
  8. 1571053Domain d3w27a_: 3w27 A: [218185]
    automated match to d3w28a_
    mutant

Details for d3w27a_

PDB Entry: 3w27 (more details), 1.41 Å

PDB Description: the high-resolution crystal structure of tsxyla, intracellular xylanase from /thermoanaerobacterium saccharolyticum jw/sl-ys485/: the complex of the e251a mutant with xylobiose
PDB Compounds: (A:) Glycoside hydrolase family 10

SCOPe Domain Sequences for d3w27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w27a_ c.1.8.0 (A:) automated matches {Thermoanaerobacterium saccharolyticum [TaxId: 1094508]}
tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
aslgveiqvtaldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
lskpnapllfdsklqakpaywaiv

SCOPe Domain Coordinates for d3w27a_:

Click to download the PDB-style file with coordinates for d3w27a_.
(The format of our PDB-style files is described here.)

Timeline for d3w27a_: