SCOPe 2.06: Domain d3w00b_: 3w00 B:

Lineage for d3w00b_ (3w00 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein PcrB protein homolog YerE [102046] (2 species)
   provisional classification; it is not known whether this protein binds FMN or not

7. Species Bacillus subtilis [TaxId:1423] [102047] (5 PDB entries)

8. Domain d3w00b_: 3w00 B: [218177]
   automated match to d3vzza_
   complexed with 1gp, fps, po4

Details for d3w00b_

PDB Entry: 3w00, 2.5 Å

PDB Description: Crystal structure of PcrB complexed with G1P and FsPP from bacillus subtilis subap. subtilis str. 168

PDB Compounds: (B:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w00b_:

Sequence; same for both SEQRES and ATOM records:

>d3w00b_ c.1.4.1 (B:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}
ydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflvp
cvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycia
npdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlets
tlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkg

Timeline for d3w00b_:

• d3w00b_ first appeared in SCOPe 2.03
  
• d3w00b_ appears in SCOPe 2.05
  
• d3w00b_ appears in SCOPe 2.07
  
• d3w00b_ appears in the current release, SCOPe 2.08