Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein PcrB protein homolog YerE [102046] (2 species) provisional classification; it is not known whether this protein binds FMN or not |
Species Bacillus subtilis [TaxId:1423] [102047] (5 PDB entries) |
Domain d3w00b_: 3w00 B: [218177] automated match to d3vzza_ complexed with 1gp, fps, po4 |
PDB Entry: 3w00 (more details), 2.5 Å
SCOPe Domain Sequences for d3w00b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w00b_ c.1.4.1 (B:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} ydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflvp cvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycia npdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlets tlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkg
Timeline for d3w00b_: