Lineage for d3vzpb_ (3vzp B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580601Species Cupriavidus necator [TaxId:381666] [224880] (4 PDB entries)
  8. 1580603Domain d3vzpb_: 3vzp B: [218161]
    automated match to d3ennd_
    complexed with dio, gol, so4

Details for d3vzpb_

PDB Entry: 3vzp (more details), 1.79 Å

PDB Description: crystal structure of phab from ralstonia eutropha
PDB Compounds: (B:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d3vzpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzpb_ c.2.1.0 (B:) automated matches {Cupriavidus necator [TaxId: 381666]}
hhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfia
segnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslf
nvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvt
vntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadf
slngglhmg

SCOPe Domain Coordinates for d3vzpb_:

Click to download the PDB-style file with coordinates for d3vzpb_.
(The format of our PDB-style files is described here.)

Timeline for d3vzpb_: