Lineage for d1svb_1 (1svb 303-395)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9661Protein Envelope glycoprotein, domain III (C-terminal) [49213] (1 species)
  7. 9662Species Tick-borne encephalitis virus [TaxId:11084] [49214] (1 PDB entry)
  8. 9663Domain d1svb_1: 1svb 303-395 [21814]
    Other proteins in same PDB: d1svb_2

Details for d1svb_1

PDB Entry: 1svb (more details), 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus

SCOP Domain Sequences for d1svb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svb_1 b.1.1.5 (303-395) Envelope glycoprotein, domain III (C-terminal) {Tick-borne encephalitis virus}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqk

SCOP Domain Coordinates for d1svb_1:

Click to download the PDB-style file with coordinates for d1svb_1.
(The format of our PDB-style files is described here.)

Timeline for d1svb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svb_2