SCOPe 2.08: Domain d3vwkd2: 3vwk D:119-246

Lineage for d3vwkd2 (3vwk D:119-246)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3vwkd2: 3vwk D:119-246 [218131]
   Other proteins in same PDB: d3vwka1, d3vwka2, d3vwkb_, d3vwkc1, d3vwkd1
   automated match to d1ktke2
   complexed with 4gh, mg, nag

Details for d3vwkd2

PDB Entry: 3vwk, 2.94 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide complex

PDB Compounds: (D:) NKT15 T cell receptor beta-chain

SCOPe Domain Sequences for d3vwkd2:

Sequence; same for both SEQRES and ATOM records:

>d3vwkd2 b.1.1.2 (D:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d3vwkd2:

• d3vwkd2 first appeared in SCOPe 2.03
  
• d3vwkd2 appears in SCOPe 2.07