Lineage for d1c7ta1 (1c7t A:781-885)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Bacterial chitobiase, c-terminal domain [49211] (1 species) Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries) 
Domain d1c7ta1: 1c7t A:781-885 [21813]
Other proteins in same PDB: d1c7ta2, d1c7ta3, d1c7ta4
Details for d1c7ta1
PDB Entry: 1c7t (more details), 1.9 Å
PDB Description: beta-n-acetylhexosaminidase mutant e540d complexed with di-n acetyl-d- glucosamine (chitobiase)
SCOP Domain Sequences for d1c7ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ta1 b.1.1.5 (A:781-885) Bacterial chitobiase, c-terminal domain {Serratia marcescens}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv
SCOP Domain Coordinates for d1c7ta1:
Click to download the PDB-style file with coordinates for d1c7ta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c7ta1:
- d1c7ta1 appears in SCOP 1.57
- d1c7ta1 appears in the current release, SCOPe 2.08
View in 3D
