SCOPe 2.04: Domain d3vwkc1: 3vwk C:2-117

Lineage for d3vwkc1 (3vwk C:2-117)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3vwkc1: 3vwk C:2-117 [218128]
   Other proteins in same PDB: d3vwka1, d3vwka2, d3vwkb_, d3vwkc2, d3vwkd2
   automated match to d1qrnd1
   complexed with 4gh, mg, nag

Details for d3vwkc1

PDB Entry: 3vwk, 2.94 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide complex

PDB Compounds: (C:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3vwkc1:

Sequence; same for both SEQRES and ATOM records:

>d3vwkc1 b.1.1.0 (C:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngry
tatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

Timeline for d3vwkc1:

• d3vwkc1 first appeared in SCOPe 2.03
  
• d3vwkc1 appears in SCOPe 2.05
  
• d3vwkc1 appears in the current release, SCOPe 2.08