SCOP 1.61: Domain d1qbb_1: 1qbb 781-885

Lineage for d1qbb_1 (1qbb 781-885)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Bacterial chitobiase, c-terminal domain [49211] (1 species)

7. Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)

8. Domain d1qbb_1: 1qbb 781-885 [21811]
   Other proteins in same PDB: d1qbb_2, d1qbb_3, d1qbb_4

Details for d1qbb_1

PDB Entry: 1qbb, 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)

SCOP Domain Sequences for d1qbb_1:

Sequence; same for both SEQRES and ATOM records:

>d1qbb_1 b.1.1.5 (781-885) Bacterial chitobiase, c-terminal domain {Serratia marcescens}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

Timeline for d1qbb_1:

• d1qbb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1qbb_1 appears in SCOP 1.59
  
• d1qbb_1 appears in SCOP 1.63
  
• d1qbb_1 appears in the current release, SCOPe 2.08, called d1qbba1