![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (296 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d3vuwa_: 3vuw A: [218106] automated match to d1ogwa_ complexed with k, zn |
PDB Entry: 3vuw (more details), 1.95 Å
SCOPe Domain Sequences for d3vuwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vuwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlr
Timeline for d3vuwa_: