Lineage for d3vsxa_ (3vsx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2801389Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2801397Species Human (Homo sapiens) [TaxId:9606] [50669] (77 PDB entries)
  8. 2801524Domain d3vsxa_: 3vsx A: [218100]
    automated match to d2v0zc_
    complexed with nag, r32

Details for d3vsxa_

PDB Entry: 3vsx (more details), 2.8 Å

PDB Description: human renin in complex with compound 18
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d3vsxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vsxa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
hamdippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d3vsxa_:

Click to download the PDB-style file with coordinates for d3vsxa_.
(The format of our PDB-style files is described here.)

Timeline for d3vsxa_: