![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species) rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases |
![]() | Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries) |
![]() | Domain d1qbaa1: 1qba A:781-885 [21810] Other proteins in same PDB: d1qbaa2, d1qbaa3, d1qbaa4 complexed with so4 |
PDB Entry: 1qba (more details), 1.85 Å
SCOPe Domain Sequences for d1qbaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbaa1 b.1.18.2 (A:781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens [TaxId: 615]} gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv
Timeline for d1qbaa1: