Lineage for d3vs6b3 (3vs6 B:250-531)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434765Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1434766Species Human (Homo sapiens) [TaxId:9606] [56152] (17 PDB entries)
  8. 1434778Domain d3vs6b3: 3vs6 B:250-531 [218099]
    Other proteins in same PDB: d3vs6a1, d3vs6a2, d3vs6b1, d3vs6b2
    automated match to d1qcfa3
    complexed with ca, cl, vsh

Details for d3vs6b3

PDB Entry: 3vs6 (more details), 2.37 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor tert-butyl {4-[4-amino-1-(propan-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl]-2-methoxyphenyl}carbamate
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs6b3:

Sequence, based on SEQRES records: (download)

>d3vs6b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records): (download)

>d3vs6b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvifpikwtapeainfgsfti
ksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwkn
rpeerptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d3vs6b3:

Click to download the PDB-style file with coordinates for d3vs6b3.
(The format of our PDB-style files is described here.)

Timeline for d3vs6b3: