Lineage for d3vs6b2 (3vs6 B:147-249)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206697Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2206698Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2206714Domain d3vs6b2: 3vs6 B:147-249 [218098]
    Other proteins in same PDB: d3vs6a1, d3vs6a3, d3vs6a4, d3vs6b1, d3vs6b3, d3vs6b4
    automated match to d1qcfa2
    complexed with ca, cl, vsh

Details for d3vs6b2

PDB Entry: 3vs6 (more details), 2.37 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor tert-butyl {4-[4-amino-1-(propan-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl]-2-methoxyphenyl}carbamate
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs6b2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d3vs6b2:

Click to download the PDB-style file with coordinates for d3vs6b2.
(The format of our PDB-style files is described here.)

Timeline for d3vs6b2: